PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g075410.1
Common NameMTR_2g075410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family BES1
Protein Properties Length: 324aa    MW: 34868.6 Da    PI: 8.2831
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g075410.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822210.73.7e-6521441150
           DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspessl 94 
                      ++++r+ptwkErEnnkrRERrRRaiaaki++GLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp e+ +++g s+  sp+ss+
  Medtr2g075410.1   2 TSGTRQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAGWIVEPDGTTYRKGCKPAERIDVIGGSTMGSPCSSY 95 
                      5899****************************************************************************************** PP

           DUF822  95 qsslkssalaspvesysaspksssfpspssldsislasa.asllpvlsvlslvsssl 150
                      +         sp++sy++sp sssfpsp s+  ++ + + +sl+p+l++ls+ sss+
  Medtr2g075410.1  96 H--------VSPCASYNPSPGSSSFPSPRSSHAVNPNGDgNSLIPWLKNLSSGSSSA 144
                      *........9******************998877665445**********9966654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.4E-643138IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MTSGTRQPTW KERENNKRRE RRRRAIAAKI FSGLRMYGNY KLPKHCDNNE VLKALCNEAG  60
WIVEPDGTTY RKGCKPAERI DVIGGSTMGS PCSSYHVSPC ASYNPSPGSS SFPSPRSSHA  120
VNPNGDGNSL IPWLKNLSSG SSSASSSKLP QLYIHTGSIS APVTPPLSSP TARSPQRKAD  180
WEDQSTRPGW GGQQYSFQPS STPPSPGRQV LDPDWFAGIR MPHSGQTSPT FSLVATNPFG  240
FREEVFCGSD SRMWTPGQSG TCSPALAAGS DHNADIPMSE AISDEFAFGS SAVGLVKPWE  300
GERIHEDSGS DDLELTLGTS KTR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.94020.0leaf| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2076010.0AC207601.5 Medicago truncatula chromosome 2 BAC clone mth2-45c5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003596275.10.0brassinazole-resistant 1 protein
SwissprotQ9ZV881e-131BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLG7IR050.0G7IR05_MEDTR; Brassinazole-resistant 1 protein
STRINGPOPTR_0001s39520.11e-154(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26613375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-118BES1/BZR1 homolog 4
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]